GenomeNet

>ctp:CTRG_00535 K00235 succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1] | (RefSeq) succinate dehydrogenase iron-sulfur protein, mitochondrial precursor (A)
MFRSVLRQQKAAQFSIRSLATATTEKAPRLKKFQVYRWNPDTPEVQPKMQTYEVDLNKCG
PMVLDALLKIKNEQDATLTLRRSCREGICGSCAMNIGGRNTLACLCRIDQDETKDLKVYP
LPHMFVVRDLVPDLTHFYKQYKSIEPYLQRDSNPADGRENLQSIEDRAKLDGLYECILCA
CCSTSCPSYWWNQQQYLGPAVLMQAYRWLIDSRDQATASRKAMLQNSMSLYRCHTIMNCT
KTCPKGLNPGRAIAEVKKQLAFD

BLAST