GenomeNet

>ctp:CTRG_00535 succinate dehydrogenase iron-sulfur protein, mitochondrial precursor; K00235 succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1] (A)
MFRSVLRQQKAAQFSIRSLATATTEKAPRLKKFQVYRWNPDTPEVQPKMQTYEVDLNKCG
PMVLDALLKIKNEQDATLTLRRSCREGICGSCAMNIGGRNTLACLCRIDQDETKDLKVYP
LPHMFVVRDLVPDLTHFYKQYKSIEPYLQRDSNPADGRENLQSIEDRAKLDGLYECILCA
CCSTSCPSYWWNQQQYLGPAVLMQAYRWLIDSRDQATASRKAMLQNSMSLYRCHTIMNCT
KTCPKGLNPGRAIAEVKKQLAFD

BLAST