GenomeNet

>ctp:CTRG_01617 K00799 glutathione S-transferase [EC:2.5.1.18] | (RefSeq) protein URE2 (A)
MSDPRHPLNSGENNNNNNNNNNNSNTNNSNNTHTISNLSAGLKSVSLADQQQNEVNLNLL
QQQLHREATTQQQQSRITQFFQNQPAEGYTLFSHRSAPNGFKVAIILSELNLPFNTIFLD
FNNGEQRAPEFVTINPNARVPALIDHYNENTSIWESGAIILYLVSKYLKENGECSLWSDN
LIEQSQISSWLFFQTSGHAPMIGQALHFRYFHSCPVPSAVERYTDEVRRVYGVVEMALAE
RREALIMDLDVENAAAYSAGTTPLSQSRYFDYPVWLVGDRATVADLSFVPWNNVVDRIGI
NLKVEFPEVYKWTKYMMRRPAVIRALRGD

BLAST