GenomeNet

>ctp:CTRG_01617 protein URE2; K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MSDPRHPLNSGENNNNNNNNNNNSNTNNSNNTHTISNLSAGLKSVSLADQQQNEVNLNLL
QQQLHREATTQQQQSRITQFFQNQPAEGYTLFSHRSAPNGFKVAIILSELNLPFNTIFLD
FNNGEQRAPEFVTINPNARVPALIDHYNENTSIWESGAIILYLVSKYLKENGECSLWSDN
LIEQSQISSWLFFQTSGHAPMIGQALHFRYFHSCPVPSAVERYTDEVRRVYGVVEMALAE
RREALIMDLDVENAAAYSAGTTPLSQSRYFDYPVWLVGDRATVADLSFVPWNNVVDRIGI
NLKVEFPEVYKWTKYMMRRPAVIRALRGD

BLAST