GenomeNet

>ctp:CTRG_03677 sporulation-specific mitogen-activated protein kinase SMK1; K08293 sporulation-specific mitogen-activated protein kinase SMK1  [EC:2.7.11.24] (A)
MTSIKSKTTNLKSCSTYTDNENHFLVDSRYEIVRVLGKGSYGVVCSAIDTKSSSSGMEHK
IAIKKVTKIFNKDILLIRAIRELKFMMFFRGHKNIATLLDLDVVYVKPYEGLYCFQELAD
LDLARVLYSNVQFSEFHIQSFMYQILCGLKYIHSADVIHRDLKPGNILVTTQGTLKICDF
GLARGINPNYFKNRSPTITNYVATRWYRAPELIMSTKSYTKAVDIWAVGCILGELFGRRP
LFPGKNSHEQIHELFKILGNPPMETIKKYNWKVEGLLWVKYRPAKWKSLYPFAPLDAIQL
LDKLLKWDYKARLDVEEILAQSFFKSLRNVFEEPSSKNIFDFSFEEKGRNIPQMKEVLES
EVKHFKETCKAGIE

BLAST