GenomeNet

>ctp:CTRG_05115 6-phosphofructokinase beta subunit; K00850 6-phosphofructokinase 1 [EC:2.7.1.11] (A)
MISIVNGTSTHSLVAGTKETLSQAINFYTNILGLSVHSENDDLTYLSNEDNKMIVKIKLD
AKTGLSPSQIHDRREDIISKLNVIDWRSLDTTNVFKVENLVALIETLSTYRYTLQITPNE
LYPNEVYCVDPLGYIVGFTACAEPLTLVPPLQKANPKFDGASNLMSKSGSQSRSVEEIKQ
VRRNIGVMTSGGDSQGMNAAVRAVVRATIFRGCKAFVIKEGYEGLVKGGPEYIKETNWQD
VRGYLSEGGTNIGTARCMEFKERWGRLLGCRHLIEAGIDGLIVCGGDGSLTGADLFRHEW
PSLIAELKEKGEITAEQYERHKHLYICGMVGSIDNDMAMTDSTIGGYSALERICRAVDYI
DATASSHSRAFVVEVMGRHCGWLALMAGIATSADYILIPEKPASSKDWKDQMCDIVGKHR
AKGKRKTIVIVAEGAITSELKPITSEEVKDVLVDRLGLDTRITVLGHVQRGGTAVAYDRI
LATLQGVEAVKAILELTPDVPSPLIAIDENKICCKPLVEAVKITKSVADAIEAQDFDKAM
SLRDHEFKEHLANFMAMNSAVHEKPTLPVEKRKKIAIVNIGAPAGGMNSAVYAMATYCMS
RGHTPYAIHNGFAGLARHESVKSMNWIDIEGWNSIGGSEIGTNRQTPEDTDIGMIAHYFE
KYQFDGLIIVGGFEAFVSLEQLERSRAMYPAFRIPMVLIPATISNNVPGTEYSLGADTCL
NSLMEYCDIVKQSASATRGTAFVVDVQGGNSGYIATYAALISGAQASYVPEEGINLSQLE
NDINSLRESFCIEREMTKSGKLIIKSSNASKVLTPHVLADIINAESHGEFDTKTAIPGHV
QQGGLPSPIDRARGDRFAIKAVQFIEDHADDLSGLRYSLEFPDDDKKIMNTAAVLGVKSS
HLKFTSIRHLYDFETELGRRMPKKIHWSNTREIADRLVGRTRI

BLAST