GenomeNet

>ctt:CtCNB1_1784 superoxide dismutase, copper/zinc binding protein; K04565 superoxide dismutase, Cu-Zn family [EC:1.15.1.1] (A)
MPYRFLILAASAAALTACSTPEPQPAQAIARLQATSGSKVGGDVKFTQKTGQQVVVNAVI
HGLKPNSEHGFHIHDKGDCGDNGNAAAGHFNPLGNPHGKYDSTQHHMGDLPSLKADSNGV
ATVNVQSADITLLAGPGNVIGRAVIVHAQPDDYTTQPTGNAGARIACAVISRD

BLAST