GenomeNet

>ctt:CtCNB1_4266 Alcohol dehydrogenase GroES-like protein; K13953 alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1] (A)
MSLPQTMKAAVVRSFGKPLTIEEMPVPRPTDDQILVKIAASGVCHTDLHAAEGDWPVKPH
PPFIPGHEGVGHVAAVGKNVKHVKEGDRVGVPWLHSACGFCRHCIGGWETLCESQTNTGY
SVNGGFADYALADPNYVGHLPSNVSFIDVAPVLCAGVTVYKGLKVTDAKPGDWVVISGIG
GLGHMAVQYAKAMGFNVAAVDIDDSKLALARQLGATVTVNAMNTDPAAYLQREIEGAHGV
LVTAVSPKAFEQALGMVRRGGTISLNGLPPGDFPLPIFSMVLKGITVRGSIVGTRLDLQE
SLDFAAQGKVKATVSTDKLENINDIFARMHEGKIEGRVVLDIAA

BLAST