GenomeNet

>ctu:CTU_29300 K11209 GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-] | (GenBank) yfcG; Uncharacterized GST-like protein yfcG (EC:2.5.1.18) (A)
MIHQSAYTLSTPNPLHKDAVMLDLYYAPTPNGHKVTLFLEEAGLEYRLHRVDISKGEQFK
PEFLAIAPNNKIPAIIDHAPSDGGPPLSLFESGAILLYLADKSGKLLSGELRERQIALQW
LFWQVAGFGPMLGQNHHFNHFAPQAVPYAIERYQVETQRLYGVLNKRLEKCPWLGGERYS
VADIATYPWVVSHERQRIDLDNFPAVSNWYERIKNRPATERAYQLASS

BLAST