GenomeNet

>ctu:CTU_29300 yfcG; GST-like protein YfcG (EC:2.5.1.18); K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MIHQSAYTLSTPNPLHKDAVMLDLYYAPTPNGHKVTLFLEEAGLEYRLHRVDISKGEQFK
PEFLAIAPNNKIPAIIDHAPSDGGPPLSLFESGAILLYLADKSGKLLSGELRERQIALQW
LFWQVAGFGPMLGQNHHFNHFAPQAVPYAIERYQVETQRLYGVLNKRLEKCPWLGGERYS
VADIATYPWVVSHERQRIDLDNFPAVSNWYERIKNRPATERAYQLASS

BLAST