GenomeNet

>ctu:CTU_29300 yfcG; Uncharacterized GST-like protein yfcG (EC:2.5.1.18); K11209 GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-] (A)
MIHQSAYTLSTPNPLHKDAVMLDLYYAPTPNGHKVTLFLEEAGLEYRLHRVDISKGEQFK
PEFLAIAPNNKIPAIIDHAPSDGGPPLSLFESGAILLYLADKSGKLLSGELRERQIALQW
LFWQVAGFGPMLGQNHHFNHFAPQAVPYAIERYQVETQRLYGVLNKRLEKCPWLGGERYS
VADIATYPWVVSHERQRIDLDNFPAVSNWYERIKNRPATERAYQLASS

BLAST