GenomeNet

>cue:CULC0102_0063 K05343 maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1] | (GenBank) hypothetical protein (A)
MFNPRNGLPVPPAWLETAIFYEIYPQTFYDSNGDGIGDVQGIVDKLDYIADLGANALWIN
PCFDSPFKDAGYDVRDYYTVAPRYGTNADLEKLFTEAHTRGIKVLLDLVPGHTSEQNDWF
QYSCKAEPNQYSDRYIWTSHAFDNGDGLPFIGGEAPRNGTYILNFFKSQPALNYGFNKKT
RPWQQSVDAPGPVANQEEMANIMRYWLDKGADGFRVDMADSLVKFDGEDKQETIKVWQKI
FARFRNDYPEAAFVSEWGKPIQALKAGFDMDFYLDWRNNGYNVLARNTDDPLGRSEDLSF
FKQSSGTSPQEFIDQYWPQYEQIRDLGYFSLISCNHDTPRLAPRLTDAERRLFFIFLLTM
PGVPFIYYGDEIGMRYLDIPTKEGGYQRTGTRTPMQWDATKKNCGFSSAPAEELYLPQDT
AADAPDAASQMLDPAALRPFVQKLIGLRSEHPELHADSDFSFLWAHDNSRILAYRRESSG
GNRCAVALNAGDAADSITLESPATIIVSSGDARVEGNTVHLGPSSGAVVELA

BLAST