GenomeNet

>cvi:CV_1775 K00799 glutathione S-transferase [EC:2.5.1.18] | (GenBank) gst3; glutathione S-transferase family protein (A)
MSPADIKLYDFALSGHSHRARLMLSLLDLEYEAVPVNLREGEHKQPAFLKLNRFGQIPVL
VDGDEVIADSNAILVYLARRYGHGDWLPSDPVREARVQRWLSAAAGPLAFGAAQARLHKW
RGVPLDYELAASRARALLQVMDEELAERPFLAGDAATIADVALYTYTAHAPEGDIPLAPY
PHVRAWLARVEALPGFVAMPPANA

BLAST