GenomeNet

>cvr:CHLNCDRAFT_29945 hypothetical protein; K01176 alpha-amylase [EC:3.2.1.1] (A)
MQACTWTRGHRSPTCRSSAVAHPRRLLARPSTVRCSALVEEKTKDAGQGKDGASGEEDAA
AALASAPATGLAAVPRPPKLPVAETICMEGFGWDSCKDGHWWKKVETTIPELQAAGITHL
WLPPPSQSVSPQGYLPGQLYNLNSNYGSKEELESLNKALLLAGIRPVADVVINHRCAQFQ
DENGVWNKYGDDPAACRWAITCDDPVFQGTGNKDSGDDYAAAPDLDHHNPELRDSLVDWL
NWLKTDVGFEGWRFDFIRGYAAKYVKEYIERTTGPDVFYVGENFVDLRWQDSNLEYNQDE
ARQKLVDFIKGTQYCTLFDFPTKGILQASPAGPLARWPRLLRADGRGKAPGLLGWWPEMA
CTFVDNHDTGSSQQHWPFPKLHVMLGYAYILTHPGIPCLFWEHHYDWGLADQINKLVALR
KRAGIRADSKLEILCAEGDMYVARCNGNVTIKMGPRYDMGGLVPKESDGWKMAAKGQDFA
IWEKA

BLAST