GenomeNet

>cvr:CHLNCDRAFT_57929 hypothetical protein; K14272 glutamate--glyoxylate aminotransferase [EC:2.6.1.4 2.6.1.2 2.6.1.44 2.6.1.-] (A)
MCMLCVARKGSALSSGARQLLSNWQCPVKASGSQLAQGRLFSSLPEPAHEPTRPNEVEGK
VAHPSLLNEDLLKAEYAVRGELYNKAMELQKQGRELIFTNVGNPQQLGQQPITFNRMVTS
LVAAPFLMGHPSAPSMFPADVLERAKKINGMFGGALGAYTDSRGNAGVRQEVADFIKQRD
GYPSNPDNIFLTDGASVAVRLLLNALIRDSSDAILVPIPQYPLYSASIQLYGGTLLPYNL
KEQTGWSMDFNEISRSVHDARNHGTNVRAMVFINPGNPTGQCLTEDNLRDLVRFAAKEKV
VLMADEVYQPNIYQDEKPFVSAKKVLGDLGKPISDSVELASFHTVSKGVLGECGLRGGYV
ELTNFHPGTVDELYKAVSINLSPNTTGQVAMSLMVNPPKPGDESYAQWKAEHDEGLASLR
RRAHAMTDGFNALDGVTCTFTEGAMYSFPRLHLPPKAIAAAAAAGKPADTFYCLQLLEAT
GIVTVPGSGFGQEEGTFHLRTTILPPEAKIGEFVKLFQDFHKAFMAKYA

BLAST