GenomeNet

>cya:CYA_1196 K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] | (GenBank) cbbS; ribulose bisphosphate carboxylase, small subunit (A)
MQTLPKERRYETFSYLPPMTDLQILKQVQYILDQGYIPAIEFNESSQPTDHYWTLWKLPL
FSATSPQEVLTEVQACRSAYPNCFIRVVGFDNIKQCQVLSFLVYKPSGLR

BLAST