GenomeNet

>cyb:CYB_2577 K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] | (GenBank) cbbS; ribulose bisphosphate carboxylase, small subunit (A)
MQTLPKERRYETLSYLPPLTDLQIIKQVQYILDQGYIPAIEFNESSEPTVRYWTLWKLPL
FSATSPQEVLSEVQACRSAYPNCFIRVVGFDNIKQCQVLSFLVYKPSGLR

BLAST