GenomeNet

>cyc:PCC7424_4716 alpha amylase catalytic protein; K01176 alpha-amylase [EC:3.2.1.1] (A)
MNYQISNFFKTCTILTLVFLVCFLTGLIPPANADVIYHAFNEPFDQIRAEIPQLKEQGYT
YIQISPPQLSNPSSEWWARYQPIDFTVLESPLGNEEDLKELIDAAHQQEEKIIVDVVLNH
MANYGDYPYTLQYPRFSPDNFHPRVCIQNYDDAYQATHGWLGLDCNSGQGGLPDLNTESD
YVRQELKNYLTTLLDLGVDGFRIDALKHIEEGFFQTVLNDIPDNIYFYGEVVEGRPIDAL
RYIGIHNIDVTDYPLLGAIKNALGLGGDLRSLMNPASYNAALPGPNAVTFAKTHDTLPGS
LLYSSYGMDQLDSLLANAFVLSREDGLPLIYRDDAEEPIVQAGVKFHEQMTGQAQYFRSG
NEIAAEADNPNLLFIERGNEGIAMINKSGNFFDVPIAQMPGLDVGCYQELHYNFTMSVGL
DQNGQKIITRWGNPTRGGIQIGPRDALFFVKSADQTCQ

BLAST