GenomeNet

>cyj:Cyan7822_0198 manganese/iron superoxide dismutase-like protein; K04564 superoxide dismutase, Fe-Mn family [EC:1.15.1.1] (A)
MAYELPVLPYDYTALEPYISKSTLEFHHDKHHAAYVNNFNKAVAGTELDSLPIEEVIKKI
AGDSSKTGVFNNAAQAWNHTFYWNSLKPNGGGTPSGAIADKINADFGSFEKFVEEFKNAG
ATQFGSGWAWLVLDNGTLKVTKTPNADNPLTAGQVPLLTMDVWEHAYYLDYQNKRPDYIE
TFISKLINWEFVNQNLAHA

BLAST