GenomeNet

>cyn:Cyan7425_0354 Glutathione S-transferase domain protein; K11209 GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-] (A)
MIELYYWTTPNGHKITLFLEEAGLPYRIIPINIGAGDQFKPEFLKISPNNRIPAIVDREP
VGGGEPLSIFESGAILLYLGEKTGQFMPADQRGRVEVLQWLFWQVGGLGPMAGQNHHFSQ
YAPEKIPYAIHRYVNETGRLYGVMNRRLSDREFLAGDYSIADMAAYPWIVSHEMQGQNLV
DFPHLSRWFATIQNRPATVRAYGQADAFKNQNIAIDQARDLLFNQSAATVPPV

BLAST