GenomeNet

>cyn:Cyan7425_1688 K00799 glutathione S-transferase [EC:2.5.1.18] | (GenBank) Glutathione S-transferase domain protein (A)
MLKLYYARPSVYARPVWLALLEKQLPFELIPVDLSGEQFEPEFLSLNPFSHVPVLVDGDF
RVIESLAILDYLEARYPDRPLLPTDPTALAKVRMAQLVTLNELVPAVFKLILHHDPRSTP
DHRNPSETVELEYAQMRAINTLNFLETLLGNSPYFAGEQLTLAEIVAGTLVHRLPDLGIP
LISYPGLHNWSRQLLSRPTWQQIELHPEEWDNLKRRMRVMPKIWERRRRHRTHALSQVQR
VGK

BLAST