GenomeNet

>cyn:Cyan7425_1904 glutathione S-transferase domain-containing protein; K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MIKLYGHELSGNSYKARLFLELLNIDYEWIKVDLSKGEHKSPEYLALNPFGQVPLLVDGE
TTLADAQAILVYLARQYGGEQWLPTEALPLAQVVRWLSTTAGEVRQGPENARLYYLFGTT
SINIERAHQKAELILMQLDQHLSDRHWLEFERPTIADVAVFPYIALAPDGKIDLAPYGNV
RAWIDRVKQLPGYMPMTGL

BLAST