GenomeNet

>dan:Dana_GF10724 K06101 histone-lysine N-methyltransferase ASH1L [EC:2.1.1.43] | (RefSeq) uncharacterized protein, isoform A (A)
MSSGQNETAAAAKVLETQESGSENEETDSITDQSSQSKSTKSATQFSVQRSDTDGLRMRI
SAIRPLPVATPVESKPPKKPVVSKSRNMSAQDTESGCSEAKNKAVSKKIRVKRKKISSGN
SGISKTEREKPHGSGFSSDSEDDLPLKVHQQRAPRLLLTAISQAAQSIEKPCLDIGISSS
DNELPSLVQAAINRVESDTEDTTVEGSFRKAAKAKNLPRYQSTLLQDFMERTQMLGQSGN
AGKLPEETVVKAKEEVAVLQTATPRKRRGRPKKVVAVLPAANSGPAINESADSGVISTTS
TTQSTTPSPKMQSETVLPAGTAPVASTSKPKIDMAYLDKRMYATERVLYPPPRSKRRQNN
KKPTSSSSNKEELQLDPLWREIDVNKKFRLRSMSVGAASATGAGTTTICSKILAAKSGYV
SDYGSVRQPRSAHNHNSGYKSDASCKSRYSTKSCMSRRSRAKSCGYRSDCKESGKSGLRM
RRKRRASMLLKTAADDPTEDQDILQLAGLSLGQSSEESNEYISKPSLQSLPTTSASKKYG
EINRYVTTGQYFGRGGSLTATNPENFISKMMNQRKETPAPSKSSCKIKSRRSSAASMCSS
YVSGMSRVRRRHRRKSFSHNKSLNIDSKLLTEIEIITSTFHSRCRIQDDRLTGSSGKEKL
MADANKLQATLTAPSPAQQLVLNGGGSGGVGALAAPLPKPVKRGLKKRKLSEPLVDFAML
SASASGAPNGSGSSTGTAKRRHKKSQSNDSSSPDDHKLPLKKRHYLLTPGERPLAETAFA
NGKLNAEAWAAAAAAAKSTASTKSQAQFNAKSAKSALTPKKRHLLEQSTPSGRQGASSAS
NSPLRIVVDNNSISGGKLLDISPSSLCSLKQQRRVGGGKQKAIATRELVQMPSPAGSYPP
PGVFEPSVELEIQIPIGKLNESVITKAEVESPLLSALDIKEDTKKEIGQRVVESLLHKTG
GNLLLKRKRKKINRTGFPTVRRKKRKVSVEQQPAVLMDEAGQAPDPDDEPLQSIRETRSS
SSAQVQVPPTNPPMDCERVPQAGEARETFVARSNQRAPRLSVVALERLQRPQTPARGRPR
GRKPKDKTVVPPPPPEPEVKVAKKRGRHPKKPPVEVAPPPPTPPAPAPRPTKTKLQPNIK
LPAGIDPNTNFSCKIRLKRRKNLDAVHQDLARTIKSKPAAPPPPPPAEDEITASQEEIDA
EAEAKRLDSIPTEHDPLPAGESLNPGPFDYASCSDTSEDKSSTVSTKKLSKVKKTYLVAG
LFSNHYKQSLMPPPAKVNKKPAQPEEQPVAPASLLPPPPYCEKYLRRSKIDFELPYDIWW
AYTNSKLPTRHVVPSWNYRKIRTNVYAESVRPNLAGFDHPTCNCKNHGEIACQDNCLNRM
VYTECSPSNCPAAEKCRNQKIQRHEVAPGVERFMTEDKGWGVRTKLPIAKGTYILEYVGE
VVTEREFKQRMASIYLNDTHHYCLHLDGGLVIDGQRMGSDCRFVNHSCEPNCEMQKWSVN
GLSRMVLFAKRAIAQGEELTYDYNFSLFNPSEGQPCRCRMPQCRGVIGGKSQRVKPLPAA
EAKPSESSPGRNGRQRKHKAKKHQQQQRAQAKDAASSVAVAKMQPLSDKEKKLVKQFNTF
LVRNFEKIRKFKAKRAAAQASSALTASASSPVQGATNGDIPGRRPSTPSSTSLLATQISA
LCTPRNMKTRGLAQAVQDPELEKMAKMAVILRDICSTLESRKMSDLLTTVSSKKKKAMKS
SLGGKQGSSAGSGRVEFRSIQAQVEQGHYKSPLEYDEHMQQLFADAKQQHGDDEGKAKAL
QSLMDCYEQQKTSSYSQLVEILGESESLQSFKPKEEELMVPTVELQKDVKKSPGTGDATP
PPTVPSIPINVLPPIEGSSDEDVIRCICGLYKDEGLMIQCAKCMVWQHTECTKADIDADN
YQCERCEPREVDREIPLEEFTEEGHRYYLSLMRGDLQVRQGDAVYVLRDIPIKDEAGKVL
PTKKHTYETIGAIDYQECDIFRVEHLWKNETGKRFIFGHHFLRPHETFHEPSRRFYPNEV
VRVSLYEVVPIELVIGRCWVLDRTTFCKGRPMECTDEDHCYICELRVDKTARFFSKAKAN
HPACTKSYAFRKFPEKLKISKSYAPHDVDPSLLKTRRQKTDLEVAGGVPATAQKTPGRQE
QQQQKAAGRKQRGVNAVTSESSSVRVLQPVAPNGQILKKKRSRLENVLITMKLKCLDAQT
AQEQPIDLSYLLSGRGARQRKTQQHSGNGNNSSNCSN

BLAST