GenomeNet

>dan:Dana_GF11072 GF11072 gene product from transcript GF11072-RA; K00235 succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1] (A)
MLVNEARQILSRVGSLTARQQLRTITNGTAQLEQQAQPKEAKEPQIKKFEIYRWNPDNAG
EKPYMQTYDVDLRECGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGTNTLAC
ISKIDTNTSKSLKVYPLPHMYVVRDLVPDMNNFYEQYRNIQPWLQRKNEAVEEKGKAQYL
QSVEDRSKLDGLYECILCACCSTSCPSYWWNAEKYLGPAVLMQAYRWIIDSRDENSAERL
SKLKDPFSVYRCHTIMNCTRTCPKGLNPGRAIAEIKKLLSGLASKPEPKLETAALHK

BLAST