GenomeNet

>dan:Dana_GF12406 K01312 trypsin [EC:3.4.21.4] | (RefSeq) uncharacterized protein (A)
MSRCWLVFLLFGVCGLGLAKGLPLQEDQGEKYLPDGRIVGGYVSDIAQCPYQISLRYKGI
TTPENPFRHRCGGSIIAEDLIVTAAHCIIATVASQYKVVAGSNYRIGSDGVVTNVKQIIM
HENYFSDAAYNNDIALLVVDPPLPLNNFTIKAIKLASEPPLAGAVSKISGWGTTSSGGTA
SDILLAVDIPIVSNEDCDADYENFGDEFYHITDAMLCAGKRGVGGVDACQGDSGGPLVVR
DELHGVVSWGNACALATHPGVYANVANLRPWIDARIAELKVNSRK

BLAST