GenomeNet

>dan:Dana_GF12622 K00844 hexokinase [EC:2.7.1.1] | (RefSeq) uncharacterized protein (A)
MLDAEVRELMQAFVLSDYQVQEVYSRFCLEVARGLKRSTHPQANVKCFPTYVQDLPTGDE
MGKYLALDLGGTNFRVLLVSLKGHHDASVESQIYAVPKDLMVGSGVDLFDHIADCLAKFV
EKHNMKTAYLPLGFTFSFPCVQVGLKEGLLVRWTKGFDCAGCEGEDVGRMLHEAIQRRGD
ADIAVVAILNDTTGTLMSCAHRNPDCRVGVIVGTGCNACYVEEVENVDLLHPDFKRTKKQ
VIINAEWGAFGEGGQLDFVRTEYDREVDEKSINRSQQLFEKMTAGMYLGNLVRLVLLRAL
ERKLIFRQSSRRPEFATVLQKHQDVFETRYISEIEDDTFPEFASTRSIVKKLFGIEKASV
EDCQTLKYICECVAKRAATLVAIGVSGLINRTSNKSVVVGMDGSVYRYHPKFDAYMREVL
VKLVKSDKAWDIMLSEDGSGRGAALVAAVASKTK

BLAST