GenomeNet

>dan:Dana_GF13315 K00006 glycerol-3-phosphate dehydrogenase (NAD+) [EC:1.1.1.8] | (RefSeq) uncharacterized protein (A)
MDKIMICIIGSGNWATTIARNVGRNVANHSTLDEKVPMYVYEEMVEGRKLTEIINTTHIN
AKYMPNFVLPPNIVAVDDIVTTARDADIIIFAIPPTFVSSCCKTLLGKVKPTAHAVSLIK
GFERGDDGQFILISQIIMRQLKIPCSVLVGCNLAHEIANDHFAEGTVGCRDQKYFRVLHD
IFRSPTFRVVVTEDADCVEICSTLRNIIAFAAGCSDGMQLNENTKAGIIRRGFLEMLQFV
DVFYPGCRMGTFFEACGISDLVTSCYANRNRKLAEAFVKTGKPLSELEHILIPGHEPLGP
VTAELVHHMLKKKGLEEKFPLFTTVYKICTGDYPLSRLVECLIKAREDIFHPLHTFQL

BLAST