GenomeNet

>dan:Dana_GF13698 K02358 elongation factor Tu | (RefSeq) uncharacterized protein (A)
MSHAFAAAVCRSAAPLALRCSRRTMSSSTARMLRLATVTTASSAAHKNWHRQGLLAANTG
NLQQYLRQYANEKKVFERTKPHCNVGTIGHVDHGKTTLTAAITKVLADKQLAESKKYNEI
DNAPEEKARGITINVAHVEYQTETRHYGHTDCPGHADYIKNMITGTAQMDGAILVVAATD
GAMPQTREHMLLAKQIGIDHIVVFINKVDAADQEMVDLVEMEIRELLTEMGYDGDKIPVV
KGSALCALEDKSPEIGKEAILKLLQEVDSFIPTPVRELDKPFLLPVENVYSIPGRGTVVT
GRLERGVVKKGMECEFVGYNKVLKSTVTGVEMFHQILEEAQAGDQLGALVRGVKRDDIKR
GMVMCKPGSVKALDQLEAQVYILSKDEGGRTKPFMSFIQLQMFSRTWDCAVQVQIPDKDM
VMPGEDTKLILRLIRPMVLEQGQRFTLRDGNLTLGTGVVTKIMPGLTETQRSELTEGKKA
REKKVAAKK

BLAST