GenomeNet

>dan:Dana_GF13942 GF13942 gene product from transcript GF13942-RA; K04371 mitogen-activated protein kinase 1/3 [EC:2.7.11.24] (A)
MVVSADDTLTNQRVAIKKISPFEHQTYCQRTLREITILTRFKHENIIDIRDILRVDSIEQ
MRDVYIVQCLMETDLYKLLKTQRLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLL
NKTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCI
LAEMLSNRPIFPGKHYLDQLNHILGVLGSPSREDLECIINEKATQGGGG

BLAST