GenomeNet

>dan:Dana_GF14126 K04440 c-Jun N-terminal kinase [EC:2.7.11.24] | (RefSeq) uncharacterized protein, isoform A (A)
MTKHKMAAQHQHYTVEVGDTNFTIHSRYINLRPIGSGAQGIVCAAYDTVTEQNVAIKKLS
RPFQNVTHAKRAYREFKLMKLVNHKNIIGLLNAFTPQRNLEEFQDVYLVMELMDANLCQV
IQMDLDHDRMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKADCTLKILDFGLARTAGT
TFMMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKII
EQLGTPSPSFMQRLQPTVRNYVENRPRYTGYSFDRLFPDGLFPSDNNQSSRRKASDARNL
LSKMLVIDPEQRISVDEALKHEYINVWYDAEEVDAPAPEPYDHSVDEREHTVEQWKELIY
EEVMDYEAHNTNNRTR

BLAST