GenomeNet

>dan:Dana_GF14126 GF14126 gene product from transcript GF14126-RA; K04440 c-Jun N-terminal kinase [EC:2.7.11.24] (A)
MAAQHQHYTVEVGDTNFTIHSRYINLRPIGSGAQGIVCAAYDTVTEQNVAIKKLSRPFQN
VTHAKRAYREFKLMKLVNHKNIIGLLNAFTPQRNLEEFQDVYLVMELMDANLCQVIQMDL
DHDRMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKADCTLKILDFGLARTAGTTFMMT
PYVVTRYYRAPEVILGMGYTENVDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLGT
PSPSFMQRLQPTVRNYVENRPRYTGYSFDRLFPDGLFPSDNNQSSRRKASDARNLLSKML
VIDPEQRISVDEALKHEYINVWYDAEEVDAPAPEPYDHSVDEREHTVEQWKELIYEEVMD
YEAHNTNNRTR

BLAST