GenomeNet

>dan:Dana_GF14260 no KO assigned | (RefSeq) uncharacterized protein (A)
MLASKNYPTHHFKESIFKPYSTSGDDLASVNTLTASAASAAMVATTSSSADTVAVDFENA
RRMLATNGGIASNGNNNNNVLDSKDSLSGFVASHPAAQFDGFIRACVDEIIKLAVFQGTN
RSSKVVEWHEPAELRQLFDFQLREKGESQDKLRELLRETIRFSVKTGHPYFINQLYSGVD
PYALVGQWLTDALNPSVYTYEVAPLFTLMEEQVLAEMRRIVGFPNGGQGDGIFCPGGSIA
NGYAISCARYKYTPESKKNGLFNAKPLIIFTSEDAHYSVEKLAMFMGFGSEHVRKIATNE
VGKMRVEDLENQIKMCLENNCQPLMVSATAGTTVLGAFDDLVGISELCKKYNMWMHVDAA
WGGGALMSKKYRHLLNGIERADSVTWNPHKLLAASQQCSTFLTPHQQILAQCHSTNATYL
FQKDKFYDTSFDTGDKHIQCGRRADVFKFWFMWKAKGSQGLEAHVEKVFRMAEFFTAKVR
ERPGFELVLDQPECTNISFWYVPPSLRQMERNREFYDRLHKVAPKVKEGMIKKGSMMITY
QPLRQLPNFFRLVLQNSCLEESDMLYFLNEIESLAQNL

BLAST