GenomeNet

>dan:Dana_GF19091 K01785 aldose 1-epimerase [EC:5.1.3.3] | (RefSeq) uncharacterized protein (A)
MVKVVEDIFGIAVNPFNKQAQVIRRYTITNTNRLSVSIIQLGATVHSISVPDAYHQTADV
VLGFDDVAGYSKYRDYKFGCCVGRVCDVVNNGEFIMDERRVIVSKNLDEKHQIDGGYVGF
DKVIWDLHMKRPDGVTLRHVSMDGHEGFPGNLAVMIHFTIDDDNRFFIRIEATTDQTTAV
NISNHIYFNLAGQNTGLDGIFGHRITIESDETMETLEGQILTTGQFKDVTDSVYDIRLPV
FMGDRVRQFEKSFIPGYDVCYAIDKEFDANITRYVGRFLHPESGRFMEIFSNQPSIRFAT
ANNFPQELHGEEPILGKRCTRYWQHAGFSLQPQNYPDAVNQPDFPRIFINPGENYFHETI
YHFGVQESWKCCADPDELEQMGEESIKT

BLAST