GenomeNet

>dan:Dana_GF20727 K00844 hexokinase [EC:2.7.1.1] | (RefSeq) uncharacterized protein (A)
MAHPEVENAIKGFLLDQEKMAEVVDRMTKEMKMGLAKDTHPRAVIKCFVSYVQDLPTGKE
RGKCLALDLGGSNFRVLLVTLNGDGSADIQSKSYVFPSTLMTGTSDELFDFIAASLGNFC
IENGLENEALPLGFTFSFPCQQKGINKGTLVAWTKGFNVPGVVGKNVVELLQQAIERRGE
VRISIVAILNDTVGTLMSCAFHNRNCRIGLIVGTGTNACYVEKTVNAECFEHYQTSPKQS
MIINCEWGAFGDNGVLDFVRTSYDRIVDKVTPNPGRQTFEKCISGMYMGEIVRLIVIEMM
AKGVMFHGETSQQIQNRWSFQTAYLSDVESDPIGEYRHTNKVIREMGFLGNNEADKINLR
RICEAVSSRSAKLCACGLVTLINKMNINEVVVGIDGSVYRYHPKYHDLLTMYMKQLLKPG
VKFELTVSEDGSGKGAALVAATAAQSK

BLAST