GenomeNet

>dan:Dana_GF24331 K00310 pyrimidodiazepine synthase [EC:1.5.4.1] | (RefSeq) uncharacterized protein (A)
MRFCPFAQRVHLVLDAKQIPYHSIYINLTDKPEWLLDKNPQGKVPALELVREPGPPVLTE
SLLICEYLDEQYPLRPLYPRDPLKKVQEKLLIERFGPVLGAFFRASDGGDLEPFWAGLDT
YEKELSRRGTDFFGGEQTGILDYMIWPWCERLELLKLQRGEEYNYDEARFPQLTLWVERM
KRDQAVMAFYMEAEVQAEFLRTRAAGHPNYNLLVKEA

BLAST