GenomeNet

>dan:Dana_GF24407 K01580 glutamate decarboxylase [EC:4.1.1.15] | (RefSeq) uncharacterized protein, isoform A (A)
MSLNPNGYKLSERTGKLTAFDLMPTTVSAGPETREFLLKVIDVLLDFVKATNDRNEKVLD
FHHPEDMKRLLDLDVPDRALPLQQLIEDCATTLKYQVKTGHPHFFNQLSCGLDLVSMAGE
WLTATANTNMFTYEIAPVFILMENVVLTKMREIIGWSGGDSILAPGGSISNLYAFLAARH
KMFPNYKEHGSVGLPGTLVMFTSDQCHYSIKSCAAVCGLGTDHCIVVPSDEHGKMITSEL
ERLILERKAKGDIPFFVNATAGTTVLGAFDDINTIADICQKYNCWMHIDAAWGGGLMMSR
KHRHPRFTGVERADSVTWNPHKLMGALLQCSTIHFKEDGLLISCNQMSAEYLFMTDKQYD
ISYDTGDKVIQCGRHNDIFKLWLQWRAKGTEGFEQQQDRLMDLVQYQLKRIREQSDRFHL
ILEPECVNVSFWYVPKRLRGVPHDSKKEVELGKICPIIKGRMMQKGTLMVGYQPDDRRPN
FFRSIISSAAVTEADVDFMLDEIHRLGDDL

BLAST