GenomeNet

>dao:Desac_0135 no KO assigned | (GenBank) DNA ligase D, 3'-phosphoesterase domain protein (A)
MSQDDPLNTYRRKRDFAATAEPMGGTLDAGEAAPVFVIQKHAARRLHYDFRLEVDGVLKS
WAVPKGPSTNPQDKRLAAPTEDHPLEYATFEGVIPPGHYGAGTVLVWDLGTYRNLTEKKG
EAIPLPQALEHGHITVWLEGKKLRGAYSLTRFKKGRDESWLLVKKNDAEADASQDLLLTR
PESVLSGRTIEEVAAANELLSEELCSR

BLAST