GenomeNet

>dao:Desac_0135 DNA ligase D, 3'-phosphoesterase domain-containing protein (A)
MSQDDPLNTYRRKRDFAATAEPMGGTLDAGEAAPVFVIQKHAARRLHYDFRLEVDGVLKS
WAVPKGPSTNPQDKRLAAPTEDHPLEYATFEGVIPPGHYGAGTVLVWDLGTYRNLTEKKG
EAIPLPQALEHGHITVWLEGKKLRGAYSLTRFKKGRDESWLLVKKNDAEADASQDLLLTR
PESVLSGRTIEEVAAANELLSEELCSR

BLAST