GenomeNet

>dap:Dacet_0804 K01921 D-alanine-D-alanine ligase [EC:6.3.2.4] | (GenBank) protein of unknown function DUF201 (A)
MKIENMKVHIAHTDVDMNSSSADKEVLDQAEEIKSALISLGAKPYVTGYKNALKKLSAHK
DRPDAVFNLVESVNGTDRDMYRAAMFFHNSYYPYTGSPYKSLQVLSDKVVMKRVMADCDI
LTPMWHKYNEPDTFFHKGEYIVKPLYEHGSFKISGESIVSMIDVDDADSKVAGMHPDNPE
IFFAERYIDGREFNISVIEVKGEPVLLPLAEIVFEGYDGKRKIVCEKAKWDENSEEASGT
VRTFGTVSKGSRLEEKIEKITLKCWDKFNLSGYARVDIRVDALGEPYVLEVNANPTLAKD
AGFFAACTEAGYSHNQMIELIILAAMRRK

BLAST