GenomeNet

>dat:HRM2_04830 alr; hypothetical protein (EC:5.1.1.1); K01775 alanine racemase [EC:5.1.1.1] (A)
MKTENPPASLVWRQIDLDAIAHNLKTLRALTKAHTAVMAVVKADAYGHGAVRVAKKALES
GVTHLGVARLHEALELRNAGINAPILVFGYIPESDVDTLIALEVSPTVFDLETACMLSER
AVAKGTHIKIHLKVDTGMGRLGILPDSRRPSSEKKGALAEVLTISALPGLKIEGIYTHFA
AADTLDKGYAEYQHQTFMAFIEGLKHLGIEIPLVHSANSAALIDLPEAHFNMVRAGIAMY
GLAPSGEVDIRSLDLRPAMEIHSIITSVKKVPKSFKVSYGMTYETEKETVIAAVPIGYAD
GFSRLFSSRGEMIVRGRKAPIAGRVCMDQTLIDVGEIPGVKPGDEVVILGTQANQRITAD
EMAETIGTINYEVISSLTARVPKIYSE

BLAST