GenomeNet

>dat:HRM2_11950 acsM2; protein AcsM2 (EC:6.2.1.1); K01895 acetyl-CoA synthetase [EC:6.2.1.1] (A)
MCLHNPFTDGVTPFMDKLSPATYDGFLKSYSIDPPENYNFAFDFIDKRAMETPGMKAMIH
VDNQENCHKFDLDFFSKQSSRLANGLVSKGITKGDKVMLLLYRRVEFWVAMLALHKIGAI
AIPSPFLLTEKDLEYRINFAEIKGIIAEDTLIPNVDRARKKCPDLTVFIGVGEKTPVNGW
ERYTPLVDQGSDLFPRPTDSAGGNDPLLIFFSSGTTGAPKMVVHTHTYPLGHVPTGLYWH
DLEPGDIQLTLADTGWGKAVWGKFYGQWMAGATVFVYDFRGKFEPKNLLKMISRHRVTTF
CGPPTVYRFLIQEDLSQYDLSCLKHCTTAGELLNDSVFHTWKKETGLSIFEGYGQTETTL
LVATFPFMEPKPGSIGKPVPGYTIHLLDMDGQICPAGVEGEICIKLGDCHPTGLFSGYVK
EADKTARACANGYYHTGDKAWADEDGYLWFLGRVDDLIKSSGYRIGPFEVESALVAHAAV
LEAAVTGVPDDVRGQAVKATVVLKTGFIPSSTLTRELQDFVKKITAPYKYPRIIDYVDEL
PKTISGKIKRAEIRAKDNA

BLAST