GenomeNet

>dat:HRM2_13230 ddlB1; protein DdlB (EC:6.3.2.4); K01921 D-alanine-D-alanine ligase [EC:6.3.2.4] (A)
MNKTIAIVHNRINNGSLPDEIDVLVQVDAVSQALSGLGYEPIAVPCDLDLNALKQTLTAM
KPAVVFNLVESLDGHGRLIQVVPALVEALGYACTGCPAEAIYLTSHKVMAKERMRSLGLP
TADWINPVPLDIPWQGAADLGPTGTWIIKSLWEHASLGLELENLVKGNSREIAALLPDRA
SALGGACFAEQFIQGREFNLSLMDTDKGVRVLPPAEIIFKGFDHDQPKIVGYRAKWVQDA
AEYHNTPRSFDFSPKDAPLIANLERLSLGCWHGFGLRGYARVDFRVDDLGNPFILEVNTN
PCISPDAGFCAALEQAGISHGQGIHMILKQSSQPIPAMG

BLAST