GenomeNet

>dat:HRM2_17490 ppc; hypothetical protein (EC:4.1.1.31); K01595 phosphoenolpyruvate carboxylase [EC:4.1.1.31] (A)
MTMNKPRRIQAFEKSVKNKFYVYNSLFLNLPFQKISNIGMLIPLLLHVCRNDLESGKAPL
EILNSFFSDHTKIQSEREKIDFMFRVIQYVERQVVLYDSVEDSAFAQLRTHGNELSLKDY
IHLSDNKRKRGVLSDKLDTFSIRIVFTAHPTQFYSPSVLDIIDNLRTLIAANNINEIDLA
LQQLGMTSLINARKPTPCDEAKNIIYFLKSVYYDAVGEMYSYIKRNVQNSVFDNPEIIQL
GFWPGGDRDGNPFVTSEITMAVADELRMTLMGCYYREIEGLERKLTFRGVDDIITTLKTC
VHDTMFDPTKTLTFEDIITPLYTIRDALVSTFNGLYLEDLDKLIDRVKLFRTHFAILDIR
QNHAVHKQAIQEILKQKNRIEESLDELEKNELISILVHENFLVEADQFQDKIVKDTVQII
SQIAAIQMKNGEKGCNRYIISNSEDIFSVLFVHGLFRWCCRDSGKIAVDIVPLFESMEGM
VHAGTIMQELFDIPEYRSHVSQRRNRQTMMLGFSDGTKDGGYLQANWSIFKTKEHLSAVC
DHNNVKAIFFDGRGGPPARGGGKTHRFYASQSQKISNHAIQLTIQGQTITSHYGSKAHFM
HNCEQLLTAGLSNSLYEQRNAISNQSRQTLDTLARLSFEKYTALKNHKMFIPYLENKSTL
KYYGETNIGSRPTRRTSKGKLELKDLRAIPFVGSWSQLKQNVPGYFGIGTSLKAFVDDGR
LNELRQLFKDVPFFKALIFNSMMSLSKCNFALTGYIAEDPNYKEFWTLLFNEYTLSKQMV
LLISDQSTLMEEEPVSKRSIEIREQIVLPLLIIQQYALQMIEQKSGYSGDYEKIVRRSLY
GNINASRNSA

BLAST