GenomeNet

>dat:HRM2_37530 pyridoxal-dependent decarboxylase family protein (EC:4.1.1.15); K01580 glutamate decarboxylase [EC:4.1.1.15] (A)
MTVTHNSKKVGQMNSNDRKNPSLIADWKTLERIFIRPEDEACRKTLVKYMEQILFGLHDF
LNSNVGVTQEISLLELTNLYRDTLISPDPEKKLENVISDIIHKIAPRAVNVASPYFVGHM
TAAIPFFMVHLKTIVAALNQNVIKLETSKVLSVIEKQVLAKIHRLIYRRDEAFYQTHVQS
VDTSLGAFTTGGTTANLMAMWVARNHFLGAGVEQQGMAAAMQAKGVERAVILVSKRGHYS
LKKAGGILGLGNSNVLAMDVDQHQRMDMKKLEVTIRNLKKDGKTGIIAVVGIAGATETGT
VDPLGEMADLCLGQGIHFHVDAAWGGPVLLSERYAPLLKGIERADSVSMDGHKQFYMPMT
SGMVYFRDPGAMDQIAYYSNYVNREGSVDLGIKSLEGSREANALILDSSLKIMGSRGYAL
MIDHGIETAKAFAAEIEQRVMFEVVTPPELNILTYRMVPPDVCRRLEHADPKGREILNGY
LDELNIYIQRTQREAGKSFVSRTRICPVPGSEGGRVVLRSVIMNPMTTNAVLREILDEQE
RIGQGFCDPIPQIL

BLAST