GenomeNet

>dat:HRM2_38760 gabT; GabT protein (EC:2.6.1.19 2.6.1.22); K07250 4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22] (A)
MTENRSDYYQKLRNKNVPQGPANITPAYIAKASGATMTDLEGKEYIDFAGGIGVNNVGHA
HPKVVAAIKDQADKFIHTCFHVGMYESYVDLAAKLNELVPGDFPKMTMFANAGAEAVENA
VKIARYATKRPAVIAMENGFHGRTLLTMSLTSKVKPYKFGFGPFAPEVYRIPYAYCYRCP
FGLKYPNCGVACADYLEDFFISNVAAESTAAIIAEPIQGEGGFVTPPPEYFPKLAAICKK
YGIALIIDEVQSGAGRTGKFLAIEHWNVEPDIVTMAKSLGGGMPLSAITGRKEFMEAPHI
GGLGGTYSGNPISCAAALAVLEILFEDKLLERSRELGEILQKRFSDLQSKFEIIGEVRGK
GPMLGMELVKDRETKEPATELTKKLTQICFDKGLILLSCGNFGNVIRTLMPFVITDAQLD
KGLSILEESLHELTK

BLAST