GenomeNet

>dau:Daud_0598 hypothetical protein; K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] (A)
MRYLVPSFSKGDPLVPTVLIGRQKVDLTNLDKVFWPEGYTKGDLVNYYHRVAPYVLRYLR
DRPIVMSRYPDGINGKHFYQKERPEYTPDWIETVLVAHEGAQRVINYIVCRDEATLVWIA
NQGAIEMHAWLGRAGRLEYPDLAVLDLDPAAGAKWRQVIDVALLARTVLAEFGLAGFPKT
SGATGVHVFIPLEPVHTYRETTRAMEAVARLVTGVCAFATTERVIERRTGKVYIDYLQNT
AGKTMAFPYSVRPLPSAPVSTPVTWEELEDLKAAKGFNIKTVPERLQNLGDPYAGLFNRH
YRLDALLELAPSPA

BLAST