GenomeNet

>dca:Desca_1522 DNA polymerase LigD, polymerase domain-containing protein; K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] (A)
MTAETATEVMIEGKKLKLTNLNKIMWPEGLTKAHLVKYYTDIAPYLLPHLKGRPIVMKRY
PHGIEGEFFYQKDCPDYAPEWISTTTIIHSAKKVNYIICNDVATLVWLANQGCIEIHAWL
SANPAVEYPNIAVIDLDPGDEATFEDVMRVALVVRQALNQLKLKGFPKTSGASGMHVFIP
INPVYSFQEVTKAMGFVAKLVTSTYASKATIERSLDKRSKNKVYVDYLQNTRGKSMAWTY
SLRPLPGAPVSTPLLWEEIESLAIDPRQFNMHNILGRLHLFGDLFAPMANQMQELDHILA
MG

BLAST