GenomeNet

>dda:Dd703_1089 K07258 serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4] | (GenBank) Beta-lactamase (A)
MNRVITSRFTKRIVLGTLLVLGVSAFSHAEDINLKTMIPAVPDIDAEAYILIDYNSGKVL
AEKNADVRRNPASLTKMMTSYVIGQAIKAGKINPNDIVTIGKDAWATGNPDFQGSSLMFL
KPGDRVPVHMLNKGIILQSGNDACVAMADYVAGSQDAFISLMNGYVKSLGLQNTQFKTVH
GLDAEGQYSSARDMALIGQALIRDVPNEYATYKEKEFTFNNIRQMNRNGLLWDSSLSVDG
IKTGHTASAGYNLVASATEGQMRLISAVLGGRTFKGRESESKKLLTWGFRFFETVAPLKA
DKEFASEPVWFGNADRVSLGVEKDAYITIPRGRMKDLKASYVLNNTELHAPLAKNQVVGT
INFQLDGKVIEQRPLVVMNDVKEGGIFGRLFDYIKLMFHRWFS

BLAST