GenomeNet

>dda:Dd703_1089 K07258 D-alanyl-D-alanine carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4] | (GenBank) Beta-lactamase (EC:3.5.2.6) (A)
MNRVITSRFTKRIVLGTLLVLGVSAFSHAEDINLKTMIPAVPDIDAEAYILIDYNSGKVL
AEKNADVRRNPASLTKMMTSYVIGQAIKAGKINPNDIVTIGKDAWATGNPDFQGSSLMFL
KPGDRVPVHMLNKGIILQSGNDACVAMADYVAGSQDAFISLMNGYVKSLGLQNTQFKTVH
GLDAEGQYSSARDMALIGQALIRDVPNEYATYKEKEFTFNNIRQMNRNGLLWDSSLSVDG
IKTGHTASAGYNLVASATEGQMRLISAVLGGRTFKGRESESKKLLTWGFRFFETVAPLKA
DKEFASEPVWFGNADRVSLGVEKDAYITIPRGRMKDLKASYVLNNTELHAPLAKNQVVGT
INFQLDGKVIEQRPLVVMNDVKEGGIFGRLFDYIKLMFHRWFS

BLAST