GenomeNet

>dda:Dd703_1956 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) Thymidine kinase (A)
MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTMVFTAEIDDRSGLGNVSSRIGLSSPAL
LFNEHTDLFLTLEQEHRQQTIHCVLIDESQFLSREQVGQLCDVVDQLDIPVLCYGLRTDF
RGELFSGSHYLLAWADKLIELKTVCHCGRKANHVLRLDQNGKPVIEGAQVVIGGNESYVS
VCRKHYKIALGLTRKENE

BLAST