GenomeNet

>ddc:Dd586_3538 K03587 cell division protein FtsI (penicillin-binding protein 3) | (GenBank) Peptidoglycan glycosyltransferase (A)
MRAARPGKVKRQEEHASFVSWRFALLCGGILLCMLGLMLRAAYLQVIAPDKLVREGDMRS
LRVQEVPTARGMISDRAGRPLAVSVPVNAVWADPKDVNDHGGISLDTRWKALADALEIPL
DQIAAKVNANPNGRFVYLARQVNPAIGEYIHKLKLPGINLRQESRRYYPSGQVTSHLIGF
TNIDGQGIEGVEKSFDRWLTGRPGERTVRKDRFGRVIEDISSVDSQAAHNLMLSIDERLQ
ALVYRELNNAVAFNKAESGTAVLVDVNTGEVLAMASSPSYNPNNLSGTPTDVIRNRAITD
IFEPGSTVKPMVVMTALQRNVVKENAVLNTLPYYINGHEIKDVARYSELTLTGVLQKSSN
VGVSHLALAMPASALVDTYSRFGLGKATNLGLVGESLGLYPNRQRWSDIERATFSFGYGL
MVTPLQLARVYATIGSFGIYRPLSITRVDPPVPGERVFSEQIVRTVVHMMESVALPGGGG
TKAAVKGYRIAIKTGTAKKVGPDGKYINKYIAYTAGVAPASNPRFALVVVINDPQAGKYY
GGAVSAPVFGAIMGGVLRTMNIEPDALATGEKSEFVINRKEGSGDRS

BLAST