GenomeNet

>ddc:Dd586_3538 Peptidoglycan glycosyltransferase (EC:2.4.1.129); K03587 cell division protein FtsI (penicillin-binding protein 3) (A)
MRAARPGKVKRQEEHASFVSWRFALLCGGILLCMLGLMLRAAYLQVIAPDKLVREGDMRS
LRVQEVPTARGMISDRAGRPLAVSVPVNAVWADPKDVNDHGGISLDTRWKALADALEIPL
DQIAAKVNANPNGRFVYLARQVNPAIGEYIHKLKLPGINLRQESRRYYPSGQVTSHLIGF
TNIDGQGIEGVEKSFDRWLTGRPGERTVRKDRFGRVIEDISSVDSQAAHNLMLSIDERLQ
ALVYRELNNAVAFNKAESGTAVLVDVNTGEVLAMASSPSYNPNNLSGTPTDVIRNRAITD
IFEPGSTVKPMVVMTALQRNVVKENAVLNTLPYYINGHEIKDVARYSELTLTGVLQKSSN
VGVSHLALAMPASALVDTYSRFGLGKATNLGLVGESLGLYPNRQRWSDIERATFSFGYGL
MVTPLQLARVYATIGSFGIYRPLSITRVDPPVPGERVFSEQIVRTVVHMMESVALPGGGG
TKAAVKGYRIAIKTGTAKKVGPDGKYINKYIAYTAGVAPASNPRFALVVVINDPQAGKYY
GGAVSAPVFGAIMGGVLRTMNIEPDALATGEKSEFVINRKEGSGDRS

BLAST