GenomeNet

>ddi:DDB_G0268024 K06067 histone deacetylase 1/2 [EC:3.5.1.98] | (RefSeq) histone deacetylase family protein (A)
MSTRKVSYFYDNEVGNHYYGPNHPMKPHRMRMTHDLVLNYGIYKKMQIFRPRKASELELT
NFHSDDYINFLKLVTPDNMHDYSKQLVKFNVREDCPVFDGMYNFCQISSGGSIGCAVKVN
SKESDVAINWAGGLHHAKKSEASGFCYTNDIVLSILELLKHHERVLYIDIDIHHGDGVEE
AFYTTDRVMTVSFHKYGDYFPGTGDVKDIGADKGKYYSLNFPLKDGIDDESYQSIFRPII
RSVMDFYRPGAVVIQCGADSLTGDRLGCFNLTLRGHAQCIEFLKSFNVPLVVLGGGGYTI
KNVARCWTYETSILVDSELKDELPYNDYLEYYGPEYRLHITPNNMENQNTKDYLEKLKIQ
LLENLRNLNHAPAAAHHDIPPDSFNYSDDEDDEDPDVRISEADRDKKVHHQGELSDSDEE
DGRRNYSNGLEATSTSRRNQVSISAYDKERPSYNSRNNNNNNNNNNNNNNNNNNNSNNNN
SHHHNEDADVDMDSG

BLAST