GenomeNet

>ddi:DDB_G0268024 histone deacetylase family protein; K06067 histone deacetylase 1/2 [EC:3.5.1.98] (A)
MSTRKVSYFYDNEVGNHYYGPNHPMKPHRMRMTHDLVLNYGIYKKMQIFRPRKASELELT
NFHSDDYINFLKLVTPDNMHDYSKQLVKFNVREDCPVFDGMYNFCQISSGGSIGCAVKVN
SKESDVAINWAGGLHHAKKSEASGFCYTNDIVLSILELLKHHERVLYIDIDIHHGDGVEE
AFYTTDRVMTVSFHKYGDYFPGTGDVKDIGADKGKYYSLNFPLKDGIDDESYQSIFRPII
RSVMDFYRPGAVVIQCGADSLTGDRLGCFNLTLRGHAQCIEFLKSFNVPLVVLGGGGYTI
KNVARCWTYETSILVDSELKDELPYNDYLEYYGPEYRLHITPNNMENQNTKDYLEKLKIQ
LLENLRNLNHAPAAAHHDIPPDSFNYSDDEDDEDPDVRISEADRDKKVHHQGELSDSDEE
DGRRNYSNGLEATSTSRRNQVSISAYDKERPSYNSRNNNNNNNNNNNNNNNNNNNSNNNN
SHHHNEDADVDMDSG

BLAST