GenomeNet

>ddi:DDB_G0268132 SET domain-containing protein; K11423 histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43] (A)
MNKKVFLNNYLNERKQLNGNEINNNNNNNNNNNYNNNNNNNNLNKDKDKDKDKERDKDRE
RIKERTKERGDKERDRDKERDRERKKEKVEKPQVAVLKQSAQHVKQQRLKEKEKGKEKEK
DKEKDKEKDKEREREKEKEKEKVKDREKEKEKEKEKEKEKVKDREKVKDREKEKEKEKER
DKLKPKDSKIKERDIEKEKVRDREKEREKIRDREKDKNSNNNIIKPKEKKDESIAKTQKN
ITIKENGNITSSSSISNSSSINNNNNNKIINKSVSTNGNGNSSNSTNNNNSNGSNGVDIK
KKPILDSKKRALPSSSSKSQTTSTSTSTSTSKLSKPIVKKKKDSNLKRIKLSNGGVVTKY
KRKKSNNDSGSDDSSYDSSDDSSGNDSSSSGSSSSSGSDDSDNSSDDDSDSSDGDSSSDN
DDDNDKNSSGSDDDEDGDSSSFDSNYSGSYDSFSDSSECDDSDCSCGKKRKNKPDSSNSK
LTNLKKPITNGNTTDNLDNGLTTSSIVVDDQQKITNEYIEKHLNSGKANPDYSDIAVLIQ
KSRNKKFGFISRNFFIERTEKILYEIDDIDICNCSKSSGSVCGDDCLNRESYVECNIEHC
ELGKKCTNQRFQRKQYSNIKPAFTGKKGWGLIANEDIEEKQFIMEYCGEVISKQTCLRRM
KEAENEKFFYFLTLDSKECLDASKRGNLARFMNHSCDPNCETQKWTVGGEVKIGIFAIKP
IPKGTELTFDYNYERFGAQKQECYCGSVNCRGYLGQKSKSSTSTTRPKQITRWKNSIVLN
HNHHVKYFLGEPIIPHSNPSSSSSSRSVSTLYNSELSPEMELQLINSKRIFLHRNVRKLK
SFYFNVFNYYSSGGGSGGNNKKLINITSTSTSNSSLNSSLNSNIKLKRKNKISDIFNI

BLAST