GenomeNet

>ddi:DDB_G0275017 HAM group protein; K11308 histone acetyltransferase MYST1 [EC:2.3.1.48] (A)
MDKQDEDIIMEEEEEDEEVEEEEEEQEEEEEEEEEKEEMVEDEEIEEPEEEEEEEEEKVV
EEEEEEEEDEEEEEEKVETEELEEEMEEDKEEEETEEKDEEEQEEEEEEEEEEEEEEEEE
EEEEEDEEIEVEKPIETNKKDKKKDTAKKNTTTTTTTTTNQKDKEKEKEEKFKNKDKEKK
KEEKAKIKIKEKVKEKEKEKEDKVEKEKEDETKKTNGNKNNNNSRRVLENGTIIFCEWRE
QQFIKCDIIEKRESELKNGTYDYYVHYHEFNRRLDEWVHESRMDFSRVIEKKQPVNSITA
INSHGGGAGGSGGGGANGENGITGGNKKQPPKRPSQKGSMVMDDDSKLSELEKEHEEITK
VKNINVIELGRYEIDTWYFSPYPEEFTKTDKLYLCEFCLKYMKKKTSLKRHALKCDLRHP
PGNEIYRSGNISMFEVDGKRNRIYCQNLGLLAKLFLDHKTLYYDVEPFLFYIMTEYDERG
CHMVGYFSKEKESPDGNNLACILTLPPYQRKGFGKLLISFSYELSKKEGKVGTPEKPLSD
LGLLSYRSYWTQVLLEILKTHKGNLSITDISNISAIRTEDVISTLQSLNLIRYWKGQHVI
HITPKTLDDHLKIYAKQTSKIDPKCIHWVPPIVNVKKHR

BLAST