GenomeNet

>ddi:DDB_G0283575 hypothetical protein; K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MTKPTLTYFPVRGRVQFPRCLLEYLGEEYNFNEVKTISDDLRKQLLFKQLPLYQEGDFKI
VQTPAIIDYISEKHDFRGKTKEERARAHQCLAGIMEVLDHCLGYSFKMDKQQQEKFRNES
PIKKFFEGFEMVLSQNKYLASGEKETYVDLMAFVMVDYVTNLGLMPSGDYPKLISLKKHY
ESSPQLKKYLESRPQSNF

BLAST