GenomeNet

>ddi:DDB_G0283857 lig3; BRCT domain-containing protein; K10776 DNA ligase 3 [EC:6.5.1.1] (A)
MSEDKSGSFYSMYKLCGQLEKESSHSGKTQLIKSFCNVFKGDLYLLAKLMLCKEDKRVFR
IKDKAMLKICSHIWDCDLDDMIEDLDNGDFTETCKKFYIEYGKYPEKSTLTLKEVDQVLD
SLTVSGKFEDQVKIINKLLKRCTPFDFRLVCRIIDSDLKINTGAKFFLDAFHPQAYDAFK
KANNLKGVIEKIQQHDFDNDNGDGDDGDGDDNDDDDGDGDSDSDKKKKKSSGGSGSDSGS
KKKSKSFEVAIKLMTPIKPMLPKAVKTVEGVVKSSECFYAEIKYDGERIQIHKDGNQFSC
YSRNLKPLMPWKVDEVKPYIPKSTKAQQMILDGEILLMDTKTSQPLPFGTLSAHKKNGFK
DATVCVFLFDILYLNGKSLIHLPLKERREILEKNVMVVKNRIEFSEVTIVNGASEKSKLT
ALLNRVFKEKLEGLVIKDAMSEYEPGCRHWIKIKKDYIHGMADSADLIAVGGYYGSGSMG
GLVTVFLMVCYDKQNKIYKTVVKASGGLDDNMIAKLQPKVTSTMTKISKEVSKIPYWLDC
PKQYAPDFIVKDIKQAMIFEIESAEFTKSDHHTTGYSMRFPRILKIRHDKDYKTATTLEE
LVEIGKDIKIVPVGKGDNNSPTTTTTTTTTTTTTTSSKLIKKQQLSDDDDDNDKDSKQQQ
QEPSKLKFVSDDLLDPFNDKSDDESNKIFILNYVDNSGIWNEKGLSGAIGKKWPSIPKSF
SQGDSNIIKSGEIRVEKVKDDSISTNKKVFICNLSCIIPPKSKKESYTFSLKEFKSAIKE
AKGAINQKKASVHLAKPQFTSPSWSELDEVLTKELYNSGIKVFVHSISKSSPTTTSPTTT
SPTTTSPKITSPSSSSSPSNKLSPLKRGRDEKLEHEIIKDIEPSLPIFEDVNAVIDSKTI
DQVDVKRLINSIKTMGGRVSDKWQQVGIGKTTHLICNGMSDLYLHVDRLGGTIVLPNWVD
QCFGSDKLLPLHEDYIYFNKKDHPDYSQSSSSSSMSIEEEKIVVTTTSDDPSEGNQQQQD
KKVIKESKIIQSKDHSSTTTIDTKITITSTNNNNNGNDNNKTRKKQHLLSIFQECIIFLH
DNVNDRETLKRYIIAYGGDISDSVNDKTTHLVASLPNNFSNVKPKDLFKSIINNNSKNNN
NNNNNNNNGIIVNSLWLWDSINMSDLLDVKNYKLF

BLAST