GenomeNet

>ddi:DDB_G0287723 K01595 phosphoenolpyruvate carboxylase [EC:4.1.1.31] | (RefSeq) hypothetical protein (A)
MGLAGDSPYDFGEIKPDDLDKSITKFQNILSNCIKDLETDGEEIIKLVKTLILTQSPGER
TTEFIEEYLKKISNLSNTEALNVSRVLSHLLNLINVAEQHHLVRSVRESFLNNEDDLKYS
CENTIQQLLNQGLDKESVYNALIQQKIELVLTAHPTQIMRRTIISKNSAMGEALSSLDNQ
QLTMFEREDYEKRLIREVGGSWLTDEVRRSKVTVEMEAQGGFSVIEQTLWHALPKFIKIL
NRCCVKYLGKELPPTFANIHVASWVGGDRDGNHNVTAEVTRQVSYFSRWIAATLYYKEID
ALLFELSMVRHNKTLEELARHSIEKRSGTVKLRYLTTLYKEFKEGIPSKECYRIVMAELR
DKMLLTKRKYEDLIAAKSDTQYLPGETFENADEILQVLQVCYDSLVEVGAKEVADGRLLD
NIRRLKSFGLTLSKMDIRQESTRHSDVINCVTEYLGLGTYNDWDEPKKQAFLIGELESKR
PLIPHDLPCSSEVREVLDTFKVAASLPNGSLGAYVISMCRNPSDILAVHLLQKAVGNKNP
QRVVPLFETAADLDSSPKTMEELFLQQWYLKSINGEQEIMLGYSDSAKDSGRFMSCWELF
KAQERLASLTEKFNVKLTLFHGRGGTAARGGGNSHEGIMSQPGGSLKSASTRVTIQGEMI
DSHYGQIGASIRNFELFTTALLKQSLTPPPPPKQRWREIMEQLSITSCKKYRSVVRENPS
FIQYFRTSTVQPEMVYLNIGSRPAKRIAAKSFGLEHLRAIPWVFSFSQNRLNLPVWLGIE
DAILEAKTKGWGSDINEMYKEWPFFSSTIDLVEMVLLKTDPQISLRYNQMLVPAQVQPLG
IEMIDELTKTTNAILELTKHKTLQQDNKILQHFVSIRRTFMDPINYIQVETLKRLRSTQK
PDGTNDDADPILIDTLIITFNGISAGMKNTG

BLAST